PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_D10CBA40D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 244aa    MW: 27310.3 Da    PI: 10.5878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_D10CBA40D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41.1e-1589136148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
  Traes_6AL_D10CBA40D.1  89 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 136
                            678*******************************************97 PP

2Myb_DNA-binding54.23.4e-17143187248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Traes_6AL_D10CBA40D.1 143 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 187
                            569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81984136IPR017930Myb domain
SuperFamilySSF466896.79E-2986183IPR009057Homeodomain-like
SMARTSM007175.3E-1188138IPR001005SANT/Myb domain
PfamPF002497.9E-1489136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2290143IPR009057Homeodomain-like
CDDcd001673.58E-1092136No hitNo description
PROSITE profilePS5129425.123137191IPR017930Myb domain
SMARTSM007176.3E-14141189IPR001005SANT/Myb domain
PfamPF002491.3E-15143187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-26144190IPR009057Homeodomain-like
CDDcd001671.00E-11145187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
FVYFPDDTNT PPFHGYKTRT YCSPLETPER SSISIPRLEP EASAAAAAAS CRPTSPRFRA  60
ALRRSSACKQ ASKAMGCKAC DKPRPSYRKG LWSPEEDQKL RDYILRHGHG CWSALPAKAG  120
LQRNGKSCRL RWINYLRPGL KHGMFSPEEE ETVMSLHAAL GNKWSRIARH LPGRTDNEVK  180
NYWNSYLKKR VEGGKETPPA ASSAADSDGS QSPSPGEFSA XXXXXXXXXX RSRRTSRRRP  240
TRAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26851923109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387441e-145BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953256.12e-88PREDICTED: myb-related protein Myb4
TrEMBLW5GAD91e-171W5GAD9_WHEAT; Uncharacterized protein
STRINGSi017947m6e-88(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.14e-57myb domain protein 19
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]